Home Linux Distributions Latestdistributions FreeBSD 6.1-RC1 has been released now
Questions:Ask|Latest



FreeBSD 6.1-RC1 has been released now
Posted on: February 7, 2008
The FreeBSD Release Engineering Team is pleased to announce the availability of FreeBSD 6.1-RC1. It is meant to be a refinement of the 6-STABLE, branch with few dramatic changes.

FreeBSD 6.1-RC1 has been released now

The FreeBSD Release Engineering Team is pleased to announce the availability of FreeBSD 6.1-RC1. It is meant to be a refinement of the 6-STABLE, branch with few dramatic changes. A lot of bugfixes have been made, some drivers have been updated, and some areas have been tweaked for better performance, etc. but no large changes have been made to the basic architecture. This RC is late in coming due to many more bugs being fixed, as well as a keyboard multiplexer being added.

About the Free BSD

FreeBSD is an advanced operating system for x86 compatible (including Pentium® and Athlon?), amd64 compatible (including Opteron?, Athlon 64, and EM64T), Alpha/AXP, IA-64, PC-98 and UltraSPARC® architectures. It is derived from BSD, the version of UNIX® developed at the University of California, Berkeley. It is developed and maintained by a large team of individuals. Additional platforms are in various stages of development.

We encourage people to help with testing so any final bugs can be identified and worked out. Availability of ISO images is given below. If you have an older system you want to update using the normal CVS/cvsup source based upgrade the branch tag to use is RELENG_6_1.  Problem reports can be submitted using the send-pr(1) command. The FreeBSD 5.5 release process is on hold while we put the final touches on 6.1. It will resume within 1-2 weeks with a 5.5-RC1 release.

The list of open issues and things still being worked on are on the todo list: http://www.freebsd.org/releases/6.1R/todo.html

For Download

The official sources for FreeBSD are available via anonymous FTP from a worldwide set of mirror sites. The site ftp://ftp.FreeBSD.org/pub/FreeBSD/ is well connected and allows a large number of connections to it, but you are probably better off finding a ?closer? mirror site (especially if you decide to set up some sort of mirror site).

The FreeBSD mirror sites database is more accurate than the mirror listing in the Handbook, as it gets its information from the DNS rather than relying on static lists of hosts.

Additionally, FreeBSD is available via anonymous FTP from the following mirror sites. If you choose to obtain FreeBSD via anonymous FTP, please try to use a site near you. The mirror sites listed as ?Primary Mirror Sites? typically have the entire FreeBSD archive (all the currently available versions for each of the architectures) but you will probably have faster download times from a site that is in your country or region. The regional sites carry the most recent versions for the most popular architecture(s) but might not carry the entire FreeBSD archive. All sites provide access via anonymous FTP but some sites also provide access via other methods. The access methods available for each site are provided in parentheses after the hostname.

Central Servers, Primary Mirror Sites, Argentina, Australia, Austria, Brazil, Bulgaria, Canada, China, Croatia, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hong Kong, Hungary, Iceland, Indonesia, Ireland, Israel, Italy, Japan, Korea, Latvia, Lithuania, Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russia, Saudi Arabia, Singapore, Slovak Republic, Slovenia, South Africa, Spain, Sweden, Switzerland, Taiwan, Turkey, Ukraine, United Kingdom, USA.

(as of 2006/03/25 21:54:18 UTC)

Central Servers

1. ftp://ftp.FreeBSD.org/pub/FreeBSD/ (ftp)

Primary Mirror Sites

In case of problems, please contact the hostmaster <mirror-admin@FreeBSD.org> for this domain.

1. ftp://ftp1.FreeBSD.org/pub/FreeBSD/ (ftp)
2. ftp://ftp2.FreeBSD.org/pub/FreeBSD/ (ftp)
3. ftp://ftp3.FreeBSD.org/pub/FreeBSD/ (ftp)
4. ftp://ftp4.FreeBSD.org/pub/FreeBSD/ (ftp)
5. ftp://ftp5.FreeBSD.org/pub/FreeBSD/ (ftp)
6. ftp://ftp6.FreeBSD.org/pub/FreeBSD/ (ftp)
7. ftp://ftp7.FreeBSD.org/pub/FreeBSD/ (ftp)
8. ftp://ftp8.FreeBSD.org/pub/FreeBSD/ (ftp)
9. ftp://ftp9.FreeBSD.org/pub/FreeBSD/ (ftp)
10. ftp://ftp10.FreeBSD.org/pub/FreeBSD/(ftp)

Related Tags for FreeBSD 6.1-RC1 has been released now:
cperformanceunixarchitecturecomformsormdatedevelopmentaspformdivupdatekeyboardbugsiomultiplefreex86versionsystemteamipdrivervikeytagchangebugintthisoperaidaidriversexefreebsdbsdbasicplatformlargeuniversityadvancedifforaddalphalextodrivelexerfixedemainratingitaxareamultirsilsamdderivedlihangsparcvarulpcpemandevfromchangesceddeinnopdarmcalstagearchitectasstaebsmntoutpartrminoperatingcaddadditionminoperatingadarcclesrmsemagepenrcmeamd64boardsysweaksxermantipspsoeeatareasanyaddedplatformsraslatekincindividualhitishallivnixdevelopeadudualandarchitecturesarberkeleytformtfxptweakupdvavarioustttwssrirdteathavstchiab6argeatietcfixetclifboamanym64iplpleplpentiummindonomo


Recommend the tutorial

Ask Questions?    Discuss: FreeBSD 6.1-RC1 has been released now  

Post your Comment


Your Name (*) :
Your Email :
Subject (*):
Your Comment (*):
  Reload Image